PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0111600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 605aa    MW: 64930.4 Da    PI: 6.5177
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0111600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.6e-093874241954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Spipo3G0111600 387 FEHflHPYPSDADKHLLARQTGLSRSQVSNWFINARVR 424
                     564459******************************88 PP

2BELL78.11.3e-252673182172
            BELL  21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rY++y e++q+ +ssF+ v+g g+a+pYt lA +a+SrhFrcLkdaia q+
  Spipo3G0111600 267 ERYSHYTEKMQATVSSFDSVMGFGAAAPYTGLARRAMSRHFRCLKDAIAAQL 318
                     7************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.1E-28193316IPR006563POX domain
PfamPF075263.7E-21267315IPR006563POX domain
PROSITE profilePS5007112.681365428IPR001356Homeobox domain
SMARTSM003894.8E-10368432IPR001356Homeobox domain
CDDcd000861.38E-13368429No hitNo description
SuperFamilySSF466891.58E-17369435IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-29371434IPR009057Homeodomain-like
PfamPF059202.0E-18385424IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MSQGFHQGIF SFSDGFGRSP ETVDSQALAA QQRRREGLRV QGFDQGEAHI SESASTPATM  60
LSDMFDFPSA GGNCAADLLV NQIPINYRLQ RPPAAAFSGN WYNPKPQGGD PQQNELAELN  120
ADSAAAMHLF LMNPSQSQQR APSPHHLHSF QSPSFVNESF RGGGVEGQGL SLSLSSSLQQ  180
LEMAQQVGYV GSIGMGNMMR HPKYAKATQE LLMEFCSTGM GLMKKGRKER RFGSFSTEPN  240
PSSSNAVGGS TAGTTALKEA LPLSPAERYS HYTEKMQATV SSFDSVMGFG AAAPYTGLAR  300
RAMSRHFRCL KDAIAAQLKH AGLLLGEKEG SGPSAITKGE TPRLRLVDQI LRQQRAFHQF  360
GAVEQESWRP QRGLPERSVN VLRAWLFEHF LHPYPSDADK HLLARQTGLS RSQVSNWFIN  420
ARVRLWKPMV EEMYQREANE AAETGDRERA TSESTTQPQP RRQRPEDMAG GTDLPHPPLA  480
SLNRGGGGGD GDGDVSAAVV GTEAIMSAGE DGVRIGILED YGAAMAAALE RTGTSGDVSL  540
TLGLRHAGST PASGGFSLAD FGGIDFSGPL LGPISWVSTR GGGNLETVDY SEVTISNETI  600
FSST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-17374431158Homeobox protein Meis1
4xrs_B1e-17374431158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395654.11e-151PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-107BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL801e-150M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0011e-150(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-103BEL1-like homeodomain 2